PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_004509751.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Cicereae; Cicer
Family G2-like
Protein Properties Length: 363aa    MW: 40497.7 Da    PI: 7.2335
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_004509751.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.84.4e-32183236255
         G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                     pr+rWt +LH+rFv+av+ LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  XP_004509751.1 183 PRMRWTATLHSRFVHAVQLLGGHERATPKSVLELMDVKDLTLSHVKSHLQMYRT 236
                     9****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466893.05E-15180236IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.605.5E-28181236IPR009057Homeodomain-like
TIGRFAMsTIGR015575.4E-24183237IPR006447Myb domain, plants
PfamPF002492.6E-7184235IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 363 aa     Download sequence    Send to blast
MELFPAQPDL SLQISLTNNN ETTSSSSWRR NTNEEEEEEE EIDLGFWKRA LDSNSRSNTF  60
DLSLSNPLSA SSSSSSSSNP NLITHPFHNN NNSNNPFHQS HYFQNQNNNK KSLSEELGFL  120
KPIRGIPVYH QKASPNNPFA LFSSQKPFDV VASSSSSTTF HSQSLMRSKF LPRFPSKRSM  180
RAPRMRWTAT LHSRFVHAVQ LLGGHERATP KSVLELMDVK DLTLSHVKSH LQMYRTGKIT  240
DRAGASSGQS DINYDNGSSG DTSEDFIFDI NSSTRSNDPP IKLPTEITNH DKENCGLWSS  300
SSEPWLHAKP NLHPLPIIPS LQGMDPKCLS NERNSDGSCS SNISGTSLKK TNLDLEFTLG  360
RSL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004509751.10.0PREDICTED: probable transcription factor KAN2
SwissprotQ9C6161e-82KAN2_ARATH; Probable transcription factor KAN2
TrEMBLG7LGX41e-140G7LGX4_MEDTR; Transcription factor KAN2
STRINGGLYMA09G34030.21e-114(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF59683452
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G32240.19e-64G2-like family protein